Detailed Information of
IPI:IPI00220644.7 - Isoform M1 of Pyruvate kinase isozymes M1/M2:

 Proteomics Data Sets:     HL-60 proteins from Uninfected cells
  Back to Previous Page
  Back to Lab Homepage

Reference (IPI#):  IPI:IPI00220644.7
Protein Name:  Isoform M1 of Pyruvate kinase isozymes M1/M2
Samples IDs &
Preparation Methods:
  YR_EC_06: Whole cell lysate from EC-infected HL-60 cells, Global Prep (Peptide_Counts: 963)
  YR_EC_05: Whole cell lysate from EC-infected HL-60 cells, Global Prep (Peptide_Counts: 944)
  YR_HL_60: Whole cell lysate from uninfected HL-60 cells, Global+Soluble+Insoluble Preps (Peptide_Counts: 944)
  YR_AP_007: Whole cell lysate from AP-infected HL-60 cells, Global Prep (Peptide_Counts: 895)
  YR_AP_010: Whole cell lysate from AP-infected HL-60 cells, Global Prep (Peptide_Counts: 678)
  YR_AP_008: Purified AP from infected HL-60 cells, Global Prep (Peptide_Counts: 482)
MS/MS Information
& Peptide Matches:
Total Numbers of Peptides Matched - 4906 (Unique Peptides - 90):
  IPI00220644.1 (Total_Count- 31 | Multiple_Proteins- 4): KGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRK;
  IPI00220644.2 (Total_Count- 40 | Multiple_Proteins- 5): GVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRK;
  IPI00220644.3 (Total_Count- 126 | Multiple_Proteins- 5): KGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIR;
  IPI00220644.4 (Total_Count- 9 | Multiple_Proteins- 4): KPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVR;
  IPI00220644.5 (Total_Count- 118 | Multiple_Proteins- 6): GVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIR;
  IPI00220644.6 (Total_Count- 2 | Multiple_Proteins- 5): TATESFASDPILYRPVAVALDTKGPEIRTGLIK;
  IPI00220644.7 (Total_Count- 9 | Multiple_Proteins- 2): RFDEILEASDGIMVARGDLGIEIPAEKVFLAQK;
  IPI00220644.8 (Total_Count- 140 | Multiple_Proteins- 5): TATESFASDPILYRPVAVALDTKGPEIR;
  IPI00220644.9 (Total_Count- 10 | Multiple_Proteins- 2): IISKIENHEGVRRFDEILEASDGIMVAR;
  IPI00220644.10 (Total_Count- 36 | Multiple_Proteins- 4): GFFKKGDVVIVLTGWRPGSGFTNTMR;
  IPI00220644.11 (Total_Count- 123 | Multiple_Proteins- 5): KGVNLPGAAVDLPAVSEKDIQDLK;
  IPI00220644.12 (Total_Count- 3 | Multiple_Proteins- 2): IENHEGVRRFDEILEASDGIMVAR;
  IPI00220644.13 (Total_Count- 50 | Multiple_Proteins- 5): TATESFASDPILYRPVAVALDTK;
  IPI00220644.14 (Total_Count- 9 | Multiple_Proteins- 6): GVNLPGAAVDLPAVSEKDIQDLK;
  IPI00220644.15 (Total_Count- 4 | Multiple_Proteins- 5): KGVNLPGAAVDLPAVSEKDIQD;
  IPI00220644.16 (Total_Count- 1 | Multiple_Proteins- 5): VVEVGSKIYVDDGLISLQVKQK;
  IPI00220644.17 (Total_Count- 1 | Multiple_Proteins- 6): DIQDLKFGVEQDVDMVFASFIR;
  IPI00220644.18 (Total_Count- 136 | Multiple_Proteins- 4): KGDVVIVLTGWRPGSGFTNTMR;
  IPI00220644.19 (Total_Count- 1 | Multiple_Proteins- 5): ASDPILYRPVAVALDTKGPEIR;
  IPI00220644.20 (Total_Count- 36 | Multiple_Proteins- 5): TGLIKGSGTAEVELKKGATLK;
  IPI00220644.21 (Total_Count- 2 | Multiple_Proteins- 5): QKGADFLVTEVENGGSLGSKK;
  IPI00220644.22 (Total_Count- 6 | Multiple_Proteins- 4): GDVVIVLTGWRPGSGFTNTMR;
  IPI00220644.23 (Total_Count- 10 | Multiple_Proteins- 4): CNRAGKPVICATQMLESMIK;
  IPI00220644.24 (Total_Count- 90 | Multiple_Proteins- 5): QKGADFLVTEVENGGSLGSK;
  IPI00220644.25 (Total_Count- 1 | Multiple_Proteins- 2): CLAAALIVLTESGRSAHQVA;
  IPI00220644.26 (Total_Count- 27 | Multiple_Proteins- 5): VVEVGSKIYVDDGLISLQVK;
  IPI00220644.27 (Total_Count- 2 | Multiple_Proteins- 5): LKFGVEQDVDMVFASFIRK;
  IPI00220644.28 (Total_Count- 6 | Multiple_Proteins- 5): PILYRPVAVALDTKGPEIR;
  IPI00220644.29 (Total_Count- 65 | Multiple_Proteins- 5): GADFLVTEVENGGSLGSKK;
  IPI00220644.30 (Total_Count- 4 | Multiple_Proteins- 5): LNFSHGTHEYHAETIKNVR;
  IPI00220644.31 (Total_Count- 2 | Multiple_Proteins- 5): TATESFASDPILYRPVAV;
  IPI00220644.32 (Total_Count- 282 | Multiple_Proteins- 5): GADFLVTEVENGGSLGSK;
  IPI00220644.33 (Total_Count- 8 | Multiple_Proteins- 5): KGVNLPGAAVDLPAVSEK;
  IPI00220644.34 (Total_Count- 100 | Multiple_Proteins- 8): GDLGIEIPAEKVFLAQK;
  IPI00220644.35 (Total_Count- 91 | Multiple_Proteins- 5): SVETLKEMIKSGMNVAR;
  IPI00220644.36 (Total_Count- 7 | Multiple_Proteins- 4): AGKPVICATQMLESMIK;
  IPI00220644.37 (Total_Count- 278 | Multiple_Proteins- 5): FGVEQDVDMVFASFIRK;
  IPI00220644.38 (Total_Count- 1 | Multiple_Proteins- 4): MLSGETAKGDYPLEAVR;
  IPI00220644.39 (Total_Count- 606 | Multiple_Proteins- 2): RFDEILEASDGIMVAR;
  IPI00220644.40 (Total_Count- 600 | Multiple_Proteins- 5): TGLIKGSGTAEVELKK;
  IPI00220644.41 (Total_Count- 1 | Multiple_Proteins- 5): TARNTGIICTIGPASR;
  IPI00220644.42 (Total_Count- 1 | Multiple_Proteins- 5): SVETLKEMIKSGMNVA;
  IPI00220644.43 (Total_Count- 4 | Multiple_Proteins- 5): GSGTAEVELKKGATLK;
  IPI00220644.44 (Total_Count- 506 | Multiple_Proteins- 6): FGVEQDVDMVFASFIR;
  IPI00220644.45 (Total_Count- 1 | Multiple_Proteins- 5): GADFLVTEVENGGSLG;
  IPI00220644.46 (Total_Count- 59 | Multiple_Proteins- 5): LNFSHGTHEYHAETIK;
  IPI00220644.47 (Total_Count- 4 | Multiple_Proteins- 5): IYVDDGLISLQVKQK;
  IPI00220644.48 (Total_Count- 44 | Multiple_Proteins- 5): FDEILEASDGIMVAR;
  IPI00220644.49 (Total_Count- 5 | Multiple_Proteins- 5): GATLKITLDNAYMEK;
  IPI00220644.50 (Total_Count- 60 | Multiple_Proteins- 5): TGLIKGSGTAEVELK;
  IPI00220644.51 (Total_Count- 1 | Multiple_Proteins- 5): SVETLKEMIKSGMNV;
  IPI00220644.52 (Total_Count- 1 | Multiple_Proteins- 2): NIKIISKIENHEGVR;
  IPI00220644.53 (Total_Count- 1 | Multiple_Proteins- 6): FGVEQDVDMVFASFI;
  IPI00220644.54 (Total_Count- 3 | Multiple_Proteins- 5): ASDVHEVRKVLGEK;
  IPI00220644.55 (Total_Count- 52 | Multiple_Proteins- 4): APIIAVTRNPQTAR;
  IPI00220644.56 (Total_Count- 3 | Multiple_Proteins- 8): GIEIPAEKVFLAQK;
  IPI00220644.57 (Total_Count- 8 | Multiple_Proteins- 2): IISKIENHEGVRR;
  IPI00220644.58 (Total_Count- 1 | Multiple_Proteins- 5): SHGTHEYHAETIK;
  IPI00220644.59 (Total_Count- 1 | Multiple_Proteins- 5): NTGIICTIGPASR;
  IPI00220644.60 (Total_Count- 3 | Multiple_Proteins- 4): FAMNVGKARGFFK;
  IPI00220644.61 (Total_Count- 218 | Multiple_Proteins- 5): IYVDDGLISLQVK;
  IPI00220644.62 (Total_Count- 112 | Multiple_Proteins- 2): IISKIENHEGVR;
  IPI00220644.63 (Total_Count- 2 | Multiple_Proteins- 4): IIAVTRNPQTAR;
  IPI00220644.64 (Total_Count- 56 | Multiple_Proteins- 5): GSGTAEVELKK;
  IPI00220644.65 (Total_Count- 2 | Multiple_Proteins- 4): IAVTRNPQTAR;
  IPI00220644.66 (Total_Count- 2 | Multiple_Proteins- 5): IYVDDGLISLQ;
  IPI00220644.67 (Total_Count- 74 | Multiple_Proteins- 5): LDIDSPPITAR;
  IPI00220644.68 (Total_Count- 78 | Multiple_Proteins- 8): GDLGIEIPAEK;
  IPI00220644.69 (Total_Count- 4 | Multiple_Proteins- 4): VNFAMNVGKAR;
  IPI00220644.70 (Total_Count- 34 | Multiple_Proteins- 5): ITLDNAYMEK;
  IPI00220644.71 (Total_Count- 12 | Multiple_Proteins- 5): VLGEKGKNIK;
  IPI00220644.72 (Total_Count- 1 | Multiple_Proteins- 4): PRAPIIAVTR;
  IPI00220644.73 (Total_Count- 98 | Multiple_Proteins- 5): SVETLKEMIK;
  IPI00220644.74 (Total_Count- 1 | Multiple_Proteins- 8): ALDTKGPEIR;
  IPI00220644.75 (Total_Count- 4 | Multiple_Proteins- 5): KASDVHEVRK;
  IPI00220644.76 (Total_Count- 13 | Multiple_Proteins- 5): GSGTAEVELK;
  IPI00220644.77 (Total_Count- 34 | Multiple_Proteins- 5): ASDVHEVRK;
  IPI00220644.78 (Total_Count- 56 | Multiple_Proteins- 5): KASDVHEVR;
  IPI00220644.79 (Total_Count- 12 | Multiple_Proteins- 4): GDYPLEAVR;
  IPI00220644.80 (Total_Count- 54 | Multiple_Proteins- 4): VNFAMNVGK;
  IPI00220644.81 (Total_Count- 2 | Multiple_Proteins- 2): EAEAAMFHR;
  IPI00220644.82 (Total_Count- 68 | Multiple_Proteins- 2): IENHEGVR;
  IPI00220644.83 (Total_Count- 14 | Multiple_Proteins- 4): APIIAVTR;
  IPI00220644.84 (Total_Count- 38 | Multiple_Proteins- 5): ASDVHEVR;
  IPI00220644.85 (Total_Count- 4 | Multiple_Proteins- 5): KVLGEKGK;
  IPI00220644.86 (Total_Count- 4 | Multiple_Proteins- 8): KVFLAQK;
  IPI00220644.87 (Total_Count- 39 | Multiple_Proteins- 5): MQHLIAR;
  IPI00220644.88 (Total_Count- 10 | Multiple_Proteins- 5): VLGEKGK;
  IPI00220644.89 (Total_Count- 1 | Multiple_Proteins- 2): LFEELVR;
  IPI00220644.90 (Total_Count- 27 | Multiple_Proteins- 12): VFLAQK;